PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c9_24170V3.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 581aa    MW: 63271.3 Da    PI: 5.725
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c9_24170V3.3.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.45.9e-171663148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+WT  Ed +l+ +v+++G g+W+++ ++ g+ R++k+c++rw ++l
  Pp3c9_24170V3.3.p 16 KGPWTSAEDSILISYVTKHGEGNWNSVQKHSGLFRCGKSCRLRWANHL 63
                       79******************************************9986 PP

2Myb_DNA-binding49.41e-1569112146
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        +g++T+eE+ ++v+++++ G++ W++ a+ ++ gRt++++k++w++
  Pp3c9_24170V3.3.p  69 KGAFTPEEERIIVELHAKIGNK-WARMAAQLP-GRTDNEIKNYWNT 112
                        799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.8291163IPR017930Myb domain
SuperFamilySSF466893.26E-2914110IPR009057Homeodomain-like
SMARTSM007177.9E-141565IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-231770IPR009057Homeodomain-like
CDDcd001671.27E-101863No hitNo description
PfamPF139217.7E-151977No hitNo description
PROSITE profilePS5129425.0564118IPR017930Myb domain
SMARTSM007173.2E-1568116IPR001005SANT/Myb domain
CDDcd001678.64E-1171112No hitNo description
Gene3DG3DSA:1.10.10.601.2E-2571118IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 581 aa     Download sequence    Send to blast
MDMSSDVGLD GGALKKGPWT SAEDSILISY VTKHGEGNWN SVQKHSGLFR CGKSCRLRWA  60
NHLRPNLKKG AFTPEEERII VELHAKIGNK WARMAAQLPG RTDNEIKNYW NTRIKRRMRA  120
GLPVYPADKS KSSPTQYYVE PSDGRSFISG KDADCDFTSS FAQPVFSVVA GDHLHNLHVS  180
NPRDSRLMRN CFSITSMSEL APSATTNQGT NHVLNKSMGN PFEQTEVFRN SQHGRSDVGN  240
GCVSFAQLAD GGNLNFQPDF NSSSQACDRG ITTRVVLPGF GNESERNMML YDRISAFGNL  300
NFLYKPPVSN ASLKLELPSC QSAESADSVG TQRSSITNPS PLIPSNNILS EAESYGSNAS  360
NFLDALMQDA HPSEELEQVR LSMDLIEQLM VHSSGNINPD VASLLLSPQK SRWGKDSDPT  420
TPLAGRTFSD HSEEASPMCQ TGNWDGPQAS AMHSFQCAPQ SGAPRTEANM REGLRGGIQQ  480
ACTDEDFLTL LDLANSDPVS EWYSPAECFS AGGLPCAPVP CAPHVDNLVP IPNFQINGGL  540
NSQSSNQSIP NYVWEFGMGT WNAASVGCHL GEFSSVEYRP *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-32141185108B-MYB
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00490DAPTransfer from AT5G06100Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S238_71V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.11e-69myb domain protein 33